PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v0559150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TCP
Protein Properties Length: 357aa    MW: 39859.2 Da    PI: 9.6786
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v0559150.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP90.14.7e-2853132383
              TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                      g+kdrhsk++T +g+RdRR+Rls+++a +++dLqd+LG+ ++sk ++WLl++ k  i++l+ +++++  +   ++ss++++
  Lj1g3v0559150.1  53 GGKDRHSKVCTIRGLRDRRIRLSVPTAVQLYDLQDKLGLNQPSKVVDWLLEATKLDIDKLPPLQFPQGFSQ-FHDSSNASD 132
                      79*************************************************************88877332.222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.8E-2754158IPR005333Transcription factor, TCP
PROSITE profilePS5136927.87654112IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MMASSREVHE SKQEGDDETF NIPRLTKASS SSIPRQWSGF KNPRIVRVSR SFGGKDRHSK  60
VCTIRGLRDR RIRLSVPTAV QLYDLQDKLG LNQPSKVVDW LLEATKLDID KLPPLQFPQG  120
FSQFHDSSNA SDLSLGPFYD YTNNFMAKSR FSWDLDSMSR VNKGKEAAER GKWIKTSYDH  180
ENRDGVIGSV GVGGGYNNSF QVSTQKLFPN TMSYNNNNYH SSEPSSLSLS QFGSHGGLFH  240
SHSQLDPSHP SSVQFPSSNL PLLSGSQFLF APTSSVPTPP SFFTPFMTTT TTSVENDPRQ  300
FNHFQFLNSS GSSQHLPHPL FPSLHSLNST PIRPFATPFN SKLLDSNNDN KDSNTRS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003522291.21e-123PREDICTED: transcription factor TCP5-like
TrEMBLA0A151S0B61e-131A0A151S0B6_CAJCA; Transcription factor TCP5
STRINGGLYMA04G32324.11e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.12e-50TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5